Hot
AOD-9604 (5mg)
Original price was: $54.99.$49.99Current price is: $49.99.
GW-501516: Cardarine (10mg/mL 50mL)
Original price was: $64.99.$54.99Current price is: $54.99.
Tesamorelin (5mg)
$59.95
- Molecular Formula:C₂₂₃H₃₇₀N₇₂O₆₉S
- Amino Acid Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Molecular Weight:5196 g/mol
- PubChem CID:44147413
- CAS Number:901758-09-6
- Description:A synthetic growth hormone-releasing hormone (GHRH) analog that is used to reduce excess abdominal fat in HIV-infected patients with lipodystrophy.
Out of stock
19
People watching this product now!
Description
- Molecular Formula:C₂₂₃H₃₇₀N₇₂O₆₉S
- Amino Acid Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Molecular Weight:5196 g/mol
- PubChem CID:44147413
- CAS Number:901758-09-6
- Description:A synthetic growth hormone-releasing hormone (GHRH) analog that is used to reduce excess abdominal fat in HIV-infected patients with lipodystrophy.
Additional information
| Weight | 6 lbs |
|---|---|
| Dimensions | .25 × .5 in |
Related products
BPC-157 (5mg,10mg)
In stock
$24.99 – $49.99
Select options
This product has multiple variants. The options may be chosen on the product page
Retatrutide (5mg, 10mg)
In stock
Original price was: $109.99.$99.95Current price is: $99.95.
Select options
This product has multiple variants. The options may be chosen on the product page
Semaglutide (5mg, 10mg)
In stock
$59.99 – $119.95
Select options
This product has multiple variants. The options may be chosen on the product page
TB-500 (5mg,10mg)
In stock
$24.99 – $59.99
Select options
This product has multiple variants. The options may be chosen on the product page
Tirz (5mg, 10mg)
In stock
Original price was: $109.99.$99.95Current price is: $99.95.
Select options
This product has multiple variants. The options may be chosen on the product page
