“Melanotan II (10 mg)” has been added to your cart. View cart
Back to products

GW-501516: Cardarine (10mg/mL 50mL)
$64.99 Original price was: $64.99.$54.99Current price is: $54.99.
Tesamorelin (5mg)
$59.95
- Molecular Formula:C₂₂₃H₃₇₀N₇₂O₆₉S
- Amino Acid Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Molecular Weight:5196 g/mol
- PubChem CID:44147413
- CAS Number:901758-09-6
- Description:A synthetic growth hormone-releasing hormone (GHRH) analog that is used to reduce excess abdominal fat in HIV-infected patients with lipodystrophy.
Out of stock
13
People watching this product now!
Categories: Atomix Research, Peptides
Description
- Molecular Formula:C₂₂₃H₃₇₀N₇₂O₆₉S
- Amino Acid Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Molecular Weight:5196 g/mol
- PubChem CID:44147413
- CAS Number:901758-09-6
- Description:A synthetic growth hormone-releasing hormone (GHRH) analog that is used to reduce excess abdominal fat in HIV-infected patients with lipodystrophy.
Additional information
Weight | 6 lbs |
---|---|
Dimensions | .25 × .5 in |
Related products
BPC-157 (5mg,10mg)
In stock
$24.99 – $49.99
Select options
This product has multiple variants. The options may be chosen on the product page
GW-501516: Cardarine (10mg/mL 50mL)
In stock
MK-677: Ibutamoren (25mg/mL 50mL)
In stock
RAD-140 (10mg/mL 50mL)
Available on backorder
Retatrutide (5mg, 10mg)
In stock
Select options
This product has multiple variants. The options may be chosen on the product page
Semaglutide (5mg, 10mg)
In stock
$59.99 – $119.95
Select options
This product has multiple variants. The options may be chosen on the product page
TB-500 (5mg,10mg)
In stock
$24.99 – $59.99
Select options
This product has multiple variants. The options may be chosen on the product page