“Semax (5mg)” has been added to your cart. View cart


IGF-1 LR3 (1 mg)
$59.99
Long-Acting IGF-1 Analog for Growth, Repair & Metabolic Research
IGF-1 LR3 is a potent synthetic analog of insulin-like growth factor 1, featuring an arginine substitution at position three and an additional 13 amino acids at the N-terminus. These modifications make it significantly more potent and longer-lasting than native IGF-1, enhancing its effectiveness in stimulating cell growth, muscle repair, and metabolic activity. Researchers use IGF-1 LR3 in studies of tissue regeneration, lean mass development, fat metabolism, and endocrine signaling. Atomix Research supplies it in high purity, ensuring consistent and reliable performance in advanced laboratory settings.
20
People watching this product now!
Categories: Atomix Research, Peptides
Description
- Synonyms: Long R3-IGF-1, LR3-IGF-1, Long arginine 3 IGF-1
- Molecular Formula: CâââHâââ NâââOâââ Sâ
- Molecular Weight: ~9117.5 g/mol
- CAS Number: 946870-92-4
- Amino Acid Sequence: MFPAMPLSSL FVNGPRTLCGA ELVDALQFVC GDRGFYFNKPT GYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Appearance: White Lyophilized Powder
 For laboratory research only â not for human use
Additional information
Weight | .5 lbs |
---|---|
Dimensions | .63 × .63 × 1.4 in |
Related products
AOD-9604 (5 mg)
In stock
Select options
This product has multiple variants. The options may be chosen on the product page
Semaglutide (5 mg, 10 mg)
In stock
$59.99 – $119.95Price range: $59.99 through $119.95
Select options
This product has multiple variants. The options may be chosen on the product page