IGF-1 LR3 (1 mg)
$59.99
Long-Acting IGF-1 Analog for Growth, Repair & Metabolic Research
IGF-1 LR3 is a potent synthetic analog of insulin-like growth factor 1, featuring an arginine substitution at position three and an additional 13 amino acids at the N-terminus. These modifications make it significantly more potent and longer-lasting than native IGF-1, enhancing its effectiveness in stimulating cell growth, muscle repair, and metabolic activity. Researchers use IGF-1 LR3 in studies of tissue regeneration, lean mass development, fat metabolism, and endocrine signaling. Atomix Research supplies it in high purity, ensuring consistent and reliable performance in advanced laboratory settings.
- Synonyms: Long R3-IGF-1, LR3-IGF-1, Long arginine 3 IGF-1
- Molecular Formula: CâââHâââ NâââOâââ Sâ
- Molecular Weight: ~9117.5 g/mol
- CAS Number: 946870-92-4
- Amino Acid Sequence: MFPAMPLSSL FVNGPRTLCGA ELVDALQFVC GDRGFYFNKPT GYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Appearance: White Lyophilized Powder
 For laboratory research only â not for human use
| Weight | .5 lbs |
|---|---|
| Dimensions | .63 × .63 × 1.4 in |
Related products
MK-2866: Ostarine (25 mg/mL, 50 mL)
In stock
RAD-140 (10 mg/mL, 50 mL)
In stock
TB-500 (5 mg, 10 mg)
In stock
Tirz (5 mg, 10 mg)
In stock


